PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv4_086160_cqyx.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 352aa    MW: 38507.3 Da    PI: 6.0441
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv4_086160_cqyx.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.74e-11219264550
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                         kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  Bv4_086160_cqyx.t1 219 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPRVA 264
                         8999*********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-14215279IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.703217269IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.64E-12219273No hitNo description
PfamPF001708.8E-10219264IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-11219270No hitNo description
CDDcd147038.26E-25220270No hitNo description
PROSITE patternPS000360222237IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MAQLPPKIPS LPHQNWPPAF PPHQRMPPLT NNISPPPTQP PQPPSSTAAN QSWVDEFLDF  60
TTTRRVTHRR SMSDSVTFLE GPHLVDECRN SGGGGGGGGG GGGGGGGGFD RLDDEQLMSM  120
FSDDISAAMV GPPSSPSDQN SNNDEENPMS TDNNNTNSNV NNDGQPQQQQ QLVQCFPKSE  180
PGEVESACHS NPDNNNQISA LPSDNANNQS AGDGTIDPKR VKRILANRQS AQRSRVRKLQ  240
YISELERSVT TLQTEVSALS PRVAFLDHQR LILNVDNSAL KQRIAALAQD KIFKDAHQEA  300
LKKEIERLRQ IYQHQQQNMK KMNNNSNNVA ATGTTQASDH NMGFTDKEQL MT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010675420.10.0PREDICTED: basic leucine zipper 34-like isoform X2
SwissprotQ9M2K43e-96BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A0J8CMI20.0A0A0J8CMI2_BETVU; Uncharacterized protein
STRINGPGSC0003DMT4000242891e-106(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.12e-60bZIP family protein